Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vi polysaccharide export inner-membrane protein vexB (vexB)

This Recombinant Vi polysaccharide export inner-membrane protein vexB (vexB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Vi polysaccharide export inner-membrane protein vexB

UniProt

P43109

Expression Region

1-264

Origin

Salmonella typhi

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNILKNNSYYFMKLITVCELIILLMSRDIKTRYNGNLLNYMMVLAVPLVWISITVISFQY LNRSVPISTDDISFVIAGILPYLLFRYTITATMRTHSFSTSLAVVSQVKKRHVIFSLAAI EFVNAVIIYIIISLINFLIFSRWEAQKPFLIFEGMVIAWLLGLSFGYFCDALSERFPLVY KAVPVMLRPMFLISAVFYTANELPYSLLSIFSWNPLLHANEIVREGMFEGYHSLYLEPFY PLAFSATLFLAGLIFHLICDTENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (NX2.1/690), CF640R conjugate, 0.1mg/mL
BNC400690-500 1x 500 µL

TTF-1 / NKX2.1 (NX2.1/690), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details