Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D3FRP0

Expression Region

1-266

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQNVIIGQYVQGNSFLHKLDPRSKLISVFILLIIIFFADNWFSSLLLVGLTVMLMAISR VPLLFLYRGLRPILWLVLFTLILHILLTKEGPVLMTLGPIAIHEGGVMNGLFIATRLLTL VMLTSLITLTTSPIDLTDGLESLFTPLKKVGLPAHELALMMSIALRFIPTFMQETEKILK AQMARGVDFSSGPISKRVKALLPLLVPLFISAFKRAEDLALAMEARGYRGGEGRTKLRVL MWNGKDSFVVVSALVIGVGIILLRNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (B-Cell Marker) (IGB/3170R), CF568 conjugate, 0.1mg/mL
BNC683170-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/3170R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,3:5,6-Di-O-isopropylidene-D-mannofuranose
TRC-D459000-5G 5 g

2,3:5,6-Di-O-isopropylidene-D-mannofuranose

Sign In for Pricing
View Details
TSPAN6 antibody
FNab09065 100 µg

TSPAN6 antibody

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL
BNC682075-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (MYOD1/2075R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Kallikrein 3/PSA Protein (Fc Tag)
PDMH100343-01 20 µg

Recombinant Human Kallikrein 3/PSA Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 3/PSA Protein (Fc Tag)
PDMH100343-02 100 µg

Recombinant Human Kallikrein 3/PSA Protein (Fc Tag)

Sign In for Pricing
View Details