Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D3FRP0

Expression Region

1-266

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQNVIIGQYVQGNSFLHKLDPRSKLISVFILLIIIFFADNWFSSLLLVGLTVMLMAISR VPLLFLYRGLRPILWLVLFTLILHILLTKEGPVLMTLGPIAIHEGGVMNGLFIATRLLTL VMLTSLITLTTSPIDLTDGLESLFTPLKKVGLPAHELALMMSIALRFIPTFMQETEKILK AQMARGVDFSSGPISKRVKALLPLLVPLFISAFKRAEDLALAMEARGYRGGEGRTKLRVL MWNGKDSFVVVSALVIGVGIILLRNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL4, ID (CCL4, LAG1, MIP1B, SCYA4, C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein, MIP-1-beta(1-69), Macrophage inflammatory protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine
MBS6282069-01 0.2 mL

CCL4, ID (CCL4, LAG1, MIP1B, SCYA4, C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein, MIP-1-beta(1-69), Macrophage inflammatory protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine

Sign In for Pricing
View Details
CCL4, ID (CCL4, LAG1, MIP1B, SCYA4, C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein, MIP-1-beta(1-69), Macrophage inflammatory protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine
MBS6282069-02 5x 0.2 mL

CCL4, ID (CCL4, LAG1, MIP1B, SCYA4, C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein, MIP-1-beta(1-69), Macrophage inflammatory protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine

Sign In for Pricing
View Details
SPINT2 polyclonal antibody
BS8408-01 50 µL

SPINT2 polyclonal antibody

Sign In for Pricing
View Details
SPINT2 polyclonal antibody
BS8408-02 100 µL

SPINT2 polyclonal antibody

Sign In for Pricing
View Details
Anti-Speedy A Antibody
CQA2802-01 30 µL

Anti-Speedy A Antibody

Sign In for Pricing
View Details
Anti-Speedy A Antibody
CQA2802-02 50 μL

Anti-Speedy A Antibody

Sign In for Pricing
View Details