Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Bacillus pseudofirmus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D3FRP0

Expression Region

1-266

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQNVIIGQYVQGNSFLHKLDPRSKLISVFILLIIIFFADNWFSSLLLVGLTVMLMAISR VPLLFLYRGLRPILWLVLFTLILHILLTKEGPVLMTLGPIAIHEGGVMNGLFIATRLLTL VMLTSLITLTTSPIDLTDGLESLFTPLKKVGLPAHELALMMSIALRFIPTFMQETEKILK AQMARGVDFSSGPISKRVKALLPLLVPLFISAFKRAEDLALAMEARGYRGGEGRTKLRVL MWNGKDSFVVVSALVIGVGIILLRNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dectin-2a (CLEC6A, C-type Lectin Domain Family 6 Member A)
216449 100 µg

Dectin-2a (CLEC6A, C-type Lectin Domain Family 6 Member A)

Sign In for Pricing
View Details
Alpelisib (Standard)
HY-15244R-01 5 mg

Alpelisib (Standard)

Sign In for Pricing
View Details
Alpelisib (Standard)
HY-15244R-02 10 mg

Alpelisib (Standard)

Sign In for Pricing
View Details
Alpelisib (Standard)
HY-15244R-03 25 mg

Alpelisib (Standard)

Sign In for Pricing
View Details
Alpelisib (Standard)
HY-15244R-04 50 mg

Alpelisib (Standard)

Sign In for Pricing
View Details
Alpelisib (Standard)
HY-15244R-05 100 mg

Alpelisib (Standard)

Sign In for Pricing
View Details