Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0721 transmembrane protein yfcA (yfcA)

This Recombinant UPF0721 transmembrane protein yfcA (yfcA) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

UPF0721 transmembrane protein yfcA

UniProt

P0AD32

Expression Region

1-269

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METFNSLFMVSPLLLGVLFFVAMLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ ACGGSISATIYFIRRKVVSLSDQKLNIAMTFVGSMSGALLVQYVQADVLRQILPILVICI GLYFLLMPKLGEEDRQRRMYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGFNLA KATAHAKLLNATSNIGGLLLFILGGKVIWATGFVMLVGQFLGARMGSRLVLSKGQKLIRP MIVIVSAVMSAKLLYDSHGQEILHWLGMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stat5a (NM_017064) Rat Tagged Lenti ORF Clone
RR204211L3 10 µg

Stat5a (NM_017064) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CSN2 Polyclonal Antibody, HRP Conjugated
A69460-100 100 µL

CSN2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
MCAD HDR Plasmid (m2)
sc-418938-HDR-2 20 µg

MCAD HDR Plasmid (m2)

Sign In for Pricing
View Details
DYNC1I1 Protein Vector (Mouse) (pPM-C-HA)
PV173840 500 ng

DYNC1I1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Porcine Lung Primary Fibroblasts
CC11L73 5x 10^5 Cells/Vial

Porcine Lung Primary Fibroblasts

Sign In for Pricing
View Details
Monkey Embigin (EMB) ELISA Kit
MBS9373242-01 48 Well

Monkey Embigin (EMB) ELISA Kit

Sign In for Pricing
View Details