Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0721 transmembrane protein yfcA (yfcA)

This Recombinant UPF0721 transmembrane protein yfcA (yfcA) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

UPF0721 transmembrane protein yfcA

UniProt

P0AD32

Expression Region

1-269

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METFNSLFMVSPLLLGVLFFVAMLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ ACGGSISATIYFIRRKVVSLSDQKLNIAMTFVGSMSGALLVQYVQADVLRQILPILVICI GLYFLLMPKLGEEDRQRRMYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGFNLA KATAHAKLLNATSNIGGLLLFILGGKVIWATGFVMLVGQFLGARMGSRLVLSKGQKLIRP MIVIVSAVMSAKLLYDSHGQEILHWLGMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXB9 Goat Polyclonal Antibody
TA311516 100 µg

HOXB9 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Albumin (ALB) Polyclonal Antibody
CAU31334-01 100 µL

Albumin (ALB) Polyclonal Antibody

Sign In for Pricing
View Details
Albumin (ALB) Polyclonal Antibody
CAU31334-02 200 µL

Albumin (ALB) Polyclonal Antibody

Sign In for Pricing
View Details
Albumin (ALB) Polyclonal Antibody
CAU31334-03 1 mL

Albumin (ALB) Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 Polyclonal Antibody
MBS9431631-01 0.05 mL

LMO2 Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 Polyclonal Antibody
MBS9431631-02 0.1 mL

LMO2 Polyclonal Antibody

Sign In for Pricing
View Details