Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Nodulin-26

This Recombinant Glycine max Nodulin-26 spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Nodulin-26, N-26

UniProt

P08995

Expression Region

1-271

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADYSAGTESQEVVVNVTKNTSETIQRSDSLVSVPFLQKLVAEAVGTYFLIFAGCASLVV NENYYNMITFPGIAIVWGLVLTVLVYTVGHISGGHFNPAVTIAFASTRRFPLIQVPAYVV AQLLGSILASGTLRLLFMGNHDQFSGTVPNGTNLQAFVFEFIMTFFLMFVICGVATDNRA VGEFAGIAIGSTLLLNVIIGGPVTGASMNPARSLGPAFVHGEYEGIWIYLLAPVVGAIAG AWVYNIVRYTDKPLSETTKSASFLKGRAASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human low molecular-weight protein/proteasome beta-type subunit,LMP7/PSMB9 ELISA Kit
CN-04344H1 96T

Human low molecular-weight protein/proteasome beta-type subunit,LMP7/PSMB9 ELISA Kit

Sign In for Pricing
View Details
Human Cold Inducible RNA Binding Protein (CIRBP) ELISA Kit
EKU03294 96 Tests

Human Cold Inducible RNA Binding Protein (CIRBP) ELISA Kit

Sign In for Pricing
View Details
MARCH6 Polyclonal Antibody, FITC Conjugated
bs-9340R-FITC 100 µL

MARCH6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
SNX29 siRNA (Human)
MBS828467-01 15 nmol

SNX29 siRNA (Human)

Sign In for Pricing
View Details
SNX29 siRNA (Human)
MBS828467-02 30 nmol

SNX29 siRNA (Human)

Sign In for Pricing
View Details
SNX29 siRNA (Human)
MBS828467-03 5x 30 nmol

SNX29 siRNA (Human)

Sign In for Pricing
View Details