Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Nodulin-26

This Recombinant Glycine max Nodulin-26 spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Nodulin-26, N-26

UniProt

P08995

Expression Region

1-271

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADYSAGTESQEVVVNVTKNTSETIQRSDSLVSVPFLQKLVAEAVGTYFLIFAGCASLVV NENYYNMITFPGIAIVWGLVLTVLVYTVGHISGGHFNPAVTIAFASTRRFPLIQVPAYVV AQLLGSILASGTLRLLFMGNHDQFSGTVPNGTNLQAFVFEFIMTFFLMFVICGVATDNRA VGEFAGIAIGSTLLLNVIIGGPVTGASMNPARSLGPAFVHGEYEGIWIYLLAPVVGAIAG AWVYNIVRYTDKPLSETTKSASFLKGRAASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transforming Growth Factor Beta 1 (TGF-β1) ELISA Kit
NSL1624Hu 96 Tests

Human Transforming Growth Factor Beta 1 (TGF-β1) ELISA Kit

Sign In for Pricing
View Details
DP1 Transcription Factor (BSA & Azide Free) (PE)
MBS6266979-01 0.1 mL

DP1 Transcription Factor (BSA & Azide Free) (PE)

Sign In for Pricing
View Details
DP1 Transcription Factor (BSA & Azide Free) (PE)
MBS6266979-02 5x 0.1 mL

DP1 Transcription Factor (BSA & Azide Free) (PE)

Sign In for Pricing
View Details
Cd209a (NM_133238) Mouse Tagged ORF Clone Lentiviral Particle
MR225861L3V 200 µL

Cd209a (NM_133238) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RAB5C (NM_201434) Human Recombinant Protein
TP310698L 1 mg

RAB5C (NM_201434) Human Recombinant Protein

Sign In for Pricing
View Details
Hamster Carbonic Anhydrase IX ELISA Kit
MBS053520-01 48 Well

Hamster Carbonic Anhydrase IX ELISA Kit

Sign In for Pricing
View Details