Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorbose permease IID component (sorM)

This Recombinant Sorbose permease IID component (sorM) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Sorbose permease IID component, EIID-Sor, PTS system sorbose-specific EIID component

UniProt

P37083

Expression Region

1-274

Origin

Klebsiella pneumoniae

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQKKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYPLKADQVAALKRH LVFFNTTPAVCGPVIAVTAAMEEARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLR PITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQLGFRKGVNIVSDMGGNLLQKL TEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGATVTMTVQNILDQLCPGLLALGLT LLMVRLLNKKVNPVWLIFALFGLGIIGNALGFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Carbonic anhydrase 9 (CA9), partial
CSB-EP614990HUc0-01 10 µg

Recombinant Human Carbonic anhydrase 9 (CA9), partial

Sign In for Pricing
View Details
Recombinant Human Carbonic anhydrase 9 (CA9), partial
CSB-EP614990HUc0-02 50 µg

Recombinant Human Carbonic anhydrase 9 (CA9), partial

Sign In for Pricing
View Details
Recombinant Human Carbonic anhydrase 9 (CA9), partial
CSB-EP614990HUc0-03 200 µg

Recombinant Human Carbonic anhydrase 9 (CA9), partial

Sign In for Pricing
View Details
Recombinant Human Carbonic anhydrase 9 (CA9), partial
CSB-EP614990HUc0-04 500 µg

Recombinant Human Carbonic anhydrase 9 (CA9), partial

Sign In for Pricing
View Details
Recombinant Human Carbonic anhydrase 9 (CA9), partial
CSB-EP614990HUc0-05 20 µg

Recombinant Human Carbonic anhydrase 9 (CA9), partial

Sign In for Pricing
View Details
Recombinant Human Carbonic anhydrase 9 (CA9), partial
CSB-EP614990HUc0-06 100 µg

Recombinant Human Carbonic anhydrase 9 (CA9), partial

Sign In for Pricing
View Details