Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorbose permease IID component (sorM)

This Recombinant Sorbose permease IID component (sorM) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Sorbose permease IID component, EIID-Sor, PTS system sorbose-specific EIID component

UniProt

P37083

Expression Region

1-274

Origin

Klebsiella pneumoniae

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQKKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYPLKADQVAALKRH LVFFNTTPAVCGPVIAVTAAMEEARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLR PITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQLGFRKGVNIVSDMGGNLLQKL TEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGATVTMTVQNILDQLCPGLLALGLT LLMVRLLNKKVNPVWLIFALFGLGIIGNALGFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC epsilon (pS729) Blocking Peptide
abx161997-01 1 mg

PKC epsilon (pS729) Blocking Peptide

Sign In for Pricing
View Details
PKC epsilon (pS729) Blocking Peptide
abx161997-02 5 mg

PKC epsilon (pS729) Blocking Peptide

Sign In for Pricing
View Details
AKR7A3 Peptide - middle region (AAP85515)
AAP85515-100UG 100 µg

AKR7A3 Peptide - middle region (AAP85515)

Sign In for Pricing
View Details
CCDC23 (SVBP) (NM_199342) Human Over-expression Lysate
LC403705 20 µg

CCDC23 (SVBP) (NM_199342) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC34A3 siRNA (Rat)
CRR3608-01 15 nmol

SLC34A3 siRNA (Rat)

Sign In for Pricing
View Details
SLC34A3 siRNA (Rat)
CRR3608-02 30 nmol

SLC34A3 siRNA (Rat)

Sign In for Pricing
View Details