Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorbose permease IID component (sorM)

This Recombinant Sorbose permease IID component (sorM) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

Sorbose permease IID component, EIID-Sor, PTS system sorbose-specific EIID component

UniProt

P37083

Expression Region

1-274

Origin

Klebsiella pneumoniae

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQKKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYPLKADQVAALKRH LVFFNTTPAVCGPVIAVTAAMEEARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLR PITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQLGFRKGVNIVSDMGGNLLQKL TEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGATVTMTVQNILDQLCPGLLALGLT LLMVRLLNKKVNPVWLIFALFGLGIIGNALGFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MESP1 Rabbit pAb
E47R9471 100 µL

MESP1 Rabbit pAb

Sign In for Pricing
View Details
Mouse CD35/CR1/CD21b Antibody , APC
E55A08334 50 Tests

Mouse CD35/CR1/CD21b Antibody , APC

Sign In for Pricing
View Details
TNNT2 Antibody
R36167-100UG 100 µg

TNNT2 Antibody

Sign In for Pricing
View Details
Elongin B Rabbit Polyclonal Antibody (BF680)
orb2413311 100 µL

Elongin B Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Hspa8 (BC006722) Mouse Tagged ORF Clone
MG209729 10 µg

Hspa8 (BC006722) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human CD59 (Protectin) ELISA Kit
MBS8821863-01 48 Well

Human CD59 (Protectin) ELISA Kit

Sign In for Pricing
View Details