Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphohydrolase 2 (Ppap2c)

This Recombinant Mouse Lipid phosphate phosphohydrolase 2 (Ppap2c) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

Q9DAX2

Expression Region

1-276

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVILVSLGEAYLVYTDRLYSRSNFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSQVNCSGYVQLEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDHKHHWSDVLVGLLQGALVACLTVR YVSDFFKSRPPQPCQEDEVPERKPSLSLTLTLGDRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK9 Recombinant Protein Antigen
NBP1-88007PEP 0.1 mL

NEK9 Recombinant Protein Antigen

Sign In for Pricing
View Details
Cytochrome C Polyclonal Antibody, RBITC Conjugated
bs-0013R-RBITC-TR 20 µL

Cytochrome C Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Morn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K5005907 1.0 µg DNA

Morn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CD160 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2526R-BF594 100 µL

CD160 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Insert WO Vial spring Silanised
CHR2978 1000 / PCK

Insert WO Vial spring Silanised

Sign In for Pricing
View Details
DsRed2 Antibody
orb3052970 100 µL

DsRed2 Antibody

Sign In for Pricing
View Details