Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphohydrolase 2 (Ppap2c)

This Recombinant Mouse Lipid phosphate phosphohydrolase 2 (Ppap2c) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

Q9DAX2

Expression Region

1-276

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVILVSLGEAYLVYTDRLYSRSNFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSQVNCSGYVQLEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDHKHHWSDVLVGLLQGALVACLTVR YVSDFFKSRPPQPCQEDEVPERKPSLSLTLTLGDRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Teredinibacter turnerae Chaperone protein DnaK (dnaK), partial
MBS1205399 Inquire

Recombinant Teredinibacter turnerae Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
Mouse Potassium channel subfamily K member 7, Kcnk7 ELISA KIT
ELI-44163m 96 Tests

Mouse Potassium channel subfamily K member 7, Kcnk7 ELISA KIT

Sign In for Pricing
View Details
VOC Std Ethanol 1000ug/mL in MeOH - 1ML
REVOC360 1 mL

VOC Std Ethanol 1000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
Rat Pde7b Pre-designed siRNA Set B
SI210229B 1 Each

Rat Pde7b Pre-designed siRNA Set B

Sign In for Pricing
View Details
IL-10 Antibody (YA4644, Rabbit)
HY-P84952-01 20 µL

IL-10 Antibody (YA4644, Rabbit)

Sign In for Pricing
View Details
IL-10 Antibody (YA4644, Rabbit)
HY-P84952-02 50 μL

IL-10 Antibody (YA4644, Rabbit)

Sign In for Pricing
View Details