Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter aurescens Undecaprenyl-diphosphatase (uppP)

This Recombinant Arthrobacter aurescens Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1R6P8

Expression Region

1-277

Origin

Arthrobacter aurescens (strain TC1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWIEAALLGLVQGLTEFLPISSSAHLRIVGSFLPNAADPGAAFTAITQLGTETAVIVYF WRDIVRIVQAWFGSLTGKVERNNPDARMGWLVILGSLPIIVLGLLFQDQIESVLRSMWIV ATMLIVFGMILAVADAVGRQERDLTQLSYKHGILYGFAQAMALIPGVSRSGGTITAGLLM GYTREAAARYSFLLAIPAVFGSGLYQLYKTVSNEGLAGPYGLPETALATVIAFVVGYVII GWFLKFVSTRSYRLFVWYRILLGLALYVLLGFNVISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-100 1x 100 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF568 conjugate, 0.1mg/mL
BNC680759-100 1x 100 µL

Human IgM Immunoglobulin (DA4-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF740 conjugate, 0.1mg/mL
BNC740687-500 1x 500 µL

Cytokeratin 8 (H1 + TS1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details