Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Brucella abortus biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q578E8

Expression Region

1-282

Origin

Brucella abortus biovar 1 (strain 9-941)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEQRPVSNLIGHLILILGIIIVAFPIYYTFVASSMTSTQIIRPPISLLPGDHLVENYRE AIFGGVERVVGVSLERLLWNSFVVAMAIAVGKIIISFMSAFAIVFFRFPMRMFFFWMIFI TLMLPVEVRILPTYKVIVDLGMIDTYAGLTLPLMASATATFLFRQFFLTIPGELVEAARI DNAGPFRFMRDILLPLSKTNIAALFVILFIYGWTQYLWPLLVTNDAKMNTIIIGLRRMVD WADASTPWNYVMVTAILAIIPLILVVVLMQRWFVKGLVETEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
BNC551037-500 1x 500 µL

CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details