Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q0I740

Expression Region

1-283

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPDPGLLEACWRDFVLGVVQGLTEFLPISSTAHLKVVPVLAGWGDPGLSVTAVIQLGSI VAVIAYFRADLAGVLKGISGAFRRGQWREPEARLGIAMLIGTLPILIAGLCIKLYWPGYA TSSLRSVPAIAVVSIVMALLLGFAELLGPRLKQLNQVDGRDGLVVGLAQVFSLIPGVSRS GSTLTASLFDGWKRADAARFSFLLGIPAITIAGLVELKDAFSGSSAGGVLPVFVGICSAA VVSWLAIDWLIKYLESHSTRIFVVYRLLFGVLLLVWWSGSASN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal GFAP Antibody (GFAP/8255R) [Janelia Fluor 635]
NBP3-24051JF635 0.1 mL

Rabbit Monoclonal GFAP Antibody (GFAP/8255R) [Janelia Fluor 635]

Sign In for Pricing
View Details
LOXL3 (NM_032603) Human Tagged ORF Clone Lentiviral Particle
RC217575L2V 200 µL

LOXL3 (NM_032603) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
D4S234E Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-8204R-PerCP-Cy5.5 100 µL

D4S234E Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human BTN3A3 Protein Lysate
MBS138129-01 0.02 mg

Human BTN3A3 Protein Lysate

Sign In for Pricing
View Details
Human BTN3A3 Protein Lysate
MBS138129-02 5x 0.02 mg

Human BTN3A3 Protein Lysate

Sign In for Pricing
View Details
Zzef1 Mouse qPCR Primer Pair (NM_001045536)
MP219121 200 Reactions

Zzef1 Mouse qPCR Primer Pair (NM_001045536)

Sign In for Pricing
View Details