Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Synechococcus sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-283.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q0I740

Expression Region

1-283

Origin

Synechococcus sp. (strain CC9311)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPDPGLLEACWRDFVLGVVQGLTEFLPISSTAHLKVVPVLAGWGDPGLSVTAVIQLGSI VAVIAYFRADLAGVLKGISGAFRRGQWREPEARLGIAMLIGTLPILIAGLCIKLYWPGYA TSSLRSVPAIAVVSIVMALLLGFAELLGPRLKQLNQVDGRDGLVVGLAQVFSLIPGVSRS GSTLTASLFDGWKRADAARFSFLLGIPAITIAGLVELKDAFSGSSAGGVLPVFVGICSAA VVSWLAIDWLIKYLESHSTRIFVVYRLLFGVLLLVWWSGSASN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RARG polyclonal antibody
BS8908-01 50 µL

RARG polyclonal antibody

Sign In for Pricing
View Details
RARG polyclonal antibody
BS8908-02 100 µL

RARG polyclonal antibody

Sign In for Pricing
View Details
NOD2 Lentiviral Activation Particles (m)
sc-434252-LAC 200 µL

NOD2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Phospho-KLF5 (Ser275) Rabbit Polyclonal Antibody (Cy3)
orb983334 100 µL

Phospho-KLF5 (Ser275) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Tnf Mouse shRNA Plasmid (Locus ID 21926)
TL515379 1 Kit

Tnf Mouse shRNA Plasmid (Locus ID 21926)

Sign In for Pricing
View Details
SDS3 CRISPR Activation Plasmid (m2)
sc-428158-ACT-2 20 µg

SDS3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details