Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae ATP synthase subunit a (atpB)

This Recombinant Verminephrobacter eiseniae ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1WF52

Expression Region

1-287

Origin

Verminephrobacter eiseniae (strain EF01-2)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASAHAPTASEYIVHHLQHLQNVPQTKIVDFSVVNYDSMVLALLLGGLTLLILWTAARK ASCGVPGRLQAAVEILVEMVDNQAKANIHNAESRKFIAPLGLVVFVWVFLMNAMDMVPVD LLPSIWGQIRQDSHEPLRVVPTADLSTTMGLALAVLGLRFWYSLKIKGAGGWAHELVSAP FGTSKNPLFALILGLVNLLMQVIEYVANTVSHGMRLFGNMYAGELVFMLIALMGGAAALS LSGVLLPVGHVIAGTLWTLFHILVITLQAFIFMMLALIYLGQAHNAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit RED Antibody
orb1527937-01 10 µL

Rabbit RED Antibody

Sign In for Pricing
View Details
Rabbit RED Antibody
orb1527937-02 100 µL

Rabbit RED Antibody

Sign In for Pricing
View Details
CaMKIV (H-5) Alexa Fluor® 546
sc-55501 AF546 200 µg/mL

CaMKIV (H-5) Alexa Fluor® 546

Sign In for Pricing
View Details
Rabbit Glycophorin-A (GYPA) ELISA Kit
MBS2607062-01 48 Well

Rabbit Glycophorin-A (GYPA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Glycophorin-A (GYPA) ELISA Kit
MBS2607062-02 96 Well

Rabbit Glycophorin-A (GYPA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Glycophorin-A (GYPA) ELISA Kit
MBS2607062-03 5x 96 Well

Rabbit Glycophorin-A (GYPA) ELISA Kit

Sign In for Pricing
View Details