Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig 5-hydroxytryptamine receptor 1D (HTR1D)

This Recombinant Pig 5-hydroxytryptamine receptor 1D (HTR1D) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D, Serotonin receptor 1D

UniProt

P79400

Expression Region

1-291

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PHOX2B Antibody
RC-16331-01 50 μL

Recombinant PHOX2B Antibody

Sign In for Pricing
View Details
Recombinant PHOX2B Antibody
RC-16331-02 100 µL

Recombinant PHOX2B Antibody

Sign In for Pricing
View Details
Recombinant PHOX2B Antibody
RC-16331-03 1 mL

Recombinant PHOX2B Antibody

Sign In for Pricing
View Details
(S)-2-Benzylaziridine
TRC-B224790-250MG 250 mg

(S)-2-Benzylaziridine

Sign In for Pricing
View Details
Tspyl5 Mouse Gene Knockout Kit (CRISPR)
KN518372 1 Kit

Tspyl5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM238 (NM_001190764) Human Recombinant Protein
TP331017 20 µg

TMEM238 (NM_001190764) Human Recombinant Protein

Sign In for Pricing
View Details