Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

This Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpA

UniProt

Q7CRU3

Expression Region

1-293

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQSVVFPNKILPYLLVAPQIILTVIFFFWPASQALYQSTMREDAFGLSSNFVGLANFSAV LSDESYLNSLKVTVIFSVLTALVSMGLALLLATAADRVVRGKGFYRTMMIMPYAVAPAVA GMLWLFMFNPAMGTLSYILRRNGIMWDPLLDGNQAMLLVVAAAAWKQISYNFLFFVAGLQ AIPKSLLEAASIDGARGSRRFWTIVFPLLAPTTFFLLVVNTVYAFFDTFGIIHAVTGGGP AKATETLVYKVYNDGFVNLNLGSSAAQSVILMVIVIALTAFQFRFVEKRVHYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-500 1x 500 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF647 conjugate, 0.1mg/mL
BNC471471-100 1x 100 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL
BNC400495-500 1x 500 µL

SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF594 conjugate, 0.1mg/mL
BNC941526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details