Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Methanococcus maripaludis Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

A4FXY4

Expression Region

1-306

Origin

Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINPIYLILADFFDRYIGEPPEKVHPVIFIGKLIIFFENVFKSTNSINKSRDLLFGFFNV ILVLAIVFFMAYEIEQVINSISNSYIRISLYSIILSFSIGHKSLIEFSKAPIRYIVNNDI DGAKKSVQCVVSRNTSELGKKHILSASIESASENITDSIIAPLIYVAIFGLPGAFLYRAV NTFDAMIGYKSEKYLYYGKTAAYLDDILNFIPSRIAGMLLIITAPFYGGKIKSAFYGFFK EGNKTPSPNSGYTMATIANSLNMGLEKIGCYKLGKGEITIEKALNSLKAVDYSVLLFLII YTVLLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant S100 alpha9 Antibody
RC-15516-01 50 μL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-02 100 µL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-03 1 mL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Disperse Yellow 1 (Technical Grade)
TRC-D495323-5G 5 g

Disperse Yellow 1 (Technical Grade)

Sign In for Pricing
View Details
ADRB3 Antibody
8G033-AAT 50 µg

ADRB3 Antibody

Sign In for Pricing
View Details
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: UB2]
AM26668RP-N 50 Tests

CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: UB2]

Sign In for Pricing
View Details