Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Protein translocase subunit SecF (secF)

This Recombinant Pseudomonas aeruginosa Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q9HXI2

Expression Region

1-306

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIKIGTINFMGIRNVAFAVTLILTVIALGSWFTKGINFGLDFTGGTLIELTYEQPADLG KVRGQLVGAGYEDAVVQSFGDARDVLVRMPSEDPELGKKVATALQQADAGNPANLKRVEY VGPQVGEELRDQGGLGMLLALGGILLYVGFRFQWKFALGAILSLVHDAIIVMGVLSFFQV TFDLTVLAAVLAVVGYSLNDTIVIFDRVRENFRVLRKADLVENLNISTSQTLLRTIATSV STLLAIAALLFFGGDNLFGFSIALFVGVMAGTYSSIYIANVVLIWLNLTSEDLIPPQAKD TVDDRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-100 1x 100 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details