Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TLC domain-containing protein 2 (Tlcd2)

This Recombinant Mouse TLC domain-containing protein 2 (Tlcd2) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

TLC domain-containing protein 2

UniProt

Q8VC26

Expression Region

1-310

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASWGLLVAGASFTAFRGLHWGLQLLPTPKSVRDRWMWRNIFVSLIHSLLSGVGALVGLW QFPQMVTDPINDHPPWARVLVAVSVGYFAADGVDMLWNQTLAQAWDLLCHHLAVVSCLST AVVSGHYVGFSMVSLLLELNSICLHLRKLLLLSHKAPSLAFRVSSWASLATLVLFRLLPL GWMSLWLSRQHYQLSLALVLLCVAGLVTVGSISISTGIRILTKDILQSQPYPFILMHKET KTREPVARNTSTLSLKGSRYLYSTAAAALGGHLMVLASPKRCMTPSVLGLQERRLEPGKV AHADNASTWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD56 Antibody[MY31]
E-AB-F1270A-01 25 µg

Purified Anti-Human CD56 Antibody[MY31]

Sign In for Pricing
View Details
Purified Anti-Human CD56 Antibody[MY31]
E-AB-F1270A-02 100 µg

Purified Anti-Human CD56 Antibody[MY31]

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein (His Tag)
PDEH101101-01 20 µg

Recombinant Human FGF21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein (His Tag)
PDEH101101-02 100 µg

Recombinant Human FGF21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein (His Tag)
PDEH101101-03 500 µg

Recombinant Human FGF21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein (His Tag)
PDEH101101-04 1 mg

Recombinant Human FGF21 Protein (His Tag)

Sign In for Pricing
View Details