Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharophagus degradans ATP synthase subunit a (atpB)

This Recombinant Saccharophagus degradans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q21DK2

Expression Region

1-311

Origin

Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSEELTATGYIQHHLQNLTYGKLPAGYVRHNADGTHTELAANTWTFAHTAQEAKDMGF MAVHVDTLGWGIFLALLLGFIFRSAVKKAHTGKPSGLLSFVEFLVEGINSVVKDIFHHKN RLIAPMGLTIFSWVFMMNLMDLIPVDWLPMLAQVVTGDSHTFFKVVPTTDPNATLGMAFT VFALMIMFSIKEKGALGFVKELTCHPFFAPKKLWYLNILLIPVNTILETVALIAKPISLG LRLFGNMYAGEMIFILIALLFSVGLVMGFVGGVLQWAWAVFHILVITLQAFIFMVLTTVY MAMAHDNHDEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-500 1x 500 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-500 1x 500 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
BNC740523-100 1x 100 µL

AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF740 conjugate, 0.1mg/mL
BNC742983-100 1x 100 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), 1mg/mL
BNUM0345-50 1x 50 µL

CD4 (EDU-2), 1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF740 conjugate, 0.1mg/mL
BNC741932-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details