Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B)

This Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, PAP-2b, PAP2b, Vascular

UniProt

O14495

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD IIDRNNHHNMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duxbl2 (NM_001177538) Mouse Untagged Clone
MC215493 10 µg

Duxbl2 (NM_001177538) Mouse Untagged Clone

Sign In for Pricing
View Details
Boc-Tyr-OtBu 100g
A22898-100000 100000 mg

Boc-Tyr-OtBu 100g

Sign In for Pricing
View Details
Rps6kb1, CT (Rps6kb1, Ribosomal protein S6 kinase beta-1, 70kD ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, p70 ribosomal S6 kinase alpha) (MaxLight 550) discontinued
041260-ML550 100 µL

Rps6kb1, CT (Rps6kb1, Ribosomal protein S6 kinase beta-1, 70kD ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, p70 ribosomal S6 kinase alpha) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ZNF432 Antibody (HRP)
orb357754-01 50 µg

ZNF432 Antibody (HRP)

Sign In for Pricing
View Details
ZNF432 Antibody (HRP)
orb357754-02 100 µg

ZNF432 Antibody (HRP)

Sign In for Pricing
View Details
Fam110c Mouse shRNA Plasmid (Locus ID 104943)
TL505711 1 Kit

Fam110c Mouse shRNA Plasmid (Locus ID 104943)

Sign In for Pricing
View Details