Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B)

This Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 3, EC= 3.1.3.4, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, PAP-2b, PAP2b, Vascular

UniProt

O14495

Expression Region

1-311

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD IIDRNNHHNMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCFD2 (NM_001171509) Human Untagged Clone
SC328161 10 µg

MCFD2 (NM_001171509) Human Untagged Clone

Sign In for Pricing
View Details
Growth Differentiation Factor 3 (GDF3) (Biotin) discontinued
G8989-39-Biotin 100 µL

Growth Differentiation Factor 3 (GDF3) (Biotin) discontinued

Sign In for Pricing
View Details
CLVS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV687259 1.0 µg DNA

CLVS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Caki-1 Cell Line
T9722 1x106 cells / 1.0 mL

Caki-1 Cell Line

Sign In for Pricing
View Details
Rat Gata Binding Protein 3 ELISA Kit
MBS006951-01 48 Well

Rat Gata Binding Protein 3 ELISA Kit

Sign In for Pricing
View Details
Rat Gata Binding Protein 3 ELISA Kit
MBS006951-02 96 Well

Rat Gata Binding Protein 3 ELISA Kit

Sign In for Pricing
View Details