Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dif-1 (dif-1)

This Recombinant Protein dif-1 (dif-1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Protein dif-1

UniProt

Q27257

Expression Region

1-312

Origin

Caenorhabditis elegans

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDVLLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKE GFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTI VMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPAS AAYLSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGK YPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAAFRYFGIGGHPT PSTEVVPLPHDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT06F4-PA/W 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS707285 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Human AKIRIN2 activation kit by CRISPRa
GA110532 1 Kit

Human AKIRIN2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS711923 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
PE2R2 Antibody
8G097-AAT 50 µg

PE2R2 Antibody

Sign In for Pricing
View Details
Recombinant Human NFYA Protein
PKSH032824-01 10 µg

Recombinant Human NFYA Protein

Sign In for Pricing
View Details