Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dif-1 (dif-1)

This Recombinant Protein dif-1 (dif-1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Protein dif-1

UniProt

Q27257

Expression Region

1-312

Origin

Caenorhabditis elegans

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDVLLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKE GFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTI VMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPAS AAYLSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGK YPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAAFRYFGIGGHPT PSTEVVPLPHDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xanthomonas campestris pv. vesicatoria Translation initiation factor IF-2 (infB), partial
MBS1438336 Inquire

Recombinant Xanthomonas campestris pv. vesicatoria Translation initiation factor IF-2 (infB), partial

Sign In for Pricing
View Details
Snake Poison Batroxobin, Biotin Conjugated
bs-2143P-Biotin 10 mg

Snake Poison Batroxobin, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Vim shRNA (UAS) - Lentiviral mouse Vim shRNA (UAS) (100)
GTR15185526 1 Vial

Lentiviral mouse Vim shRNA (UAS) - Lentiviral mouse Vim shRNA (UAS) (100)

Sign In for Pricing
View Details
PLD1 (Phospholipase D1, phosphatidylcholine-Specific) (FITC)
250201-FITC 100 µL

PLD1 (Phospholipase D1, phosphatidylcholine-Specific) (FITC)

Sign In for Pricing
View Details
Pigeon Tyrosine-Protein Kinase ZAP-70 (ZAP70) ELISA Kit
MBS9941369 Inquire

Pigeon Tyrosine-Protein Kinase ZAP-70 (ZAP70) ELISA Kit

Sign In for Pricing
View Details
C14orf100 Protein Vector (Human) (pPM-C-HA)
PV004947 500 ng

C14orf100 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details