Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein dif-1 (dif-1)

This Recombinant Protein dif-1 (dif-1) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Protein dif-1

UniProt

Q27257

Expression Region

1-312

Origin

Caenorhabditis elegans

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDVLLNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKE GFFALYKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEMTFIQNANAGALAGVFTTI VMVPGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPAS AAYLSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQTAPEGK YPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFFGLELTLAAFRYFGIGGHPT PSTEVVPLPHDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mal-PEG-HZ, 20K
HE022019-20K 1 g

Mal-PEG-HZ, 20K

Sign In for Pricing
View Details
Anti-Doublecortin (DCX)
FY-AB47487-01 1 mL

Anti-Doublecortin (DCX)

Sign In for Pricing
View Details
Anti-Doublecortin (DCX)
FY-AB47487-02 100 µL

Anti-Doublecortin (DCX)

Sign In for Pricing
View Details
Anti-Doublecortin (DCX)
FY-AB47487-03 200 µL

Anti-Doublecortin (DCX)

Sign In for Pricing
View Details
Angiotensin III Polyclonal Antibody, Cy3 Conjugated
bs-20101R-Cy3 100 µL

Angiotensin III Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Hsd3b3 Mouse shRNA Plasmid (Locus ID 15494)
TR501007 1 Kit

Hsd3b3 Mouse shRNA Plasmid (Locus ID 15494)

Sign In for Pricing
View Details