Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0761 membrane protein VV1_0885 (VV1_0885)

This Recombinant UPF0761 membrane protein VV1_0885 (VV1_0885) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

UPF0761 membrane protein VV1_0885

UniProt

Q8DDS2

Expression Region

1-313

Origin

Vibrio vulnificus

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQLFGSDKLRLPQRAQAGIAFVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSI LSKFSVFENVGSVLQSFIINNFVPASGDAVHAALQEFIANTGKMTAVGAAFLFVAALMLI SNIDKNLNYIWRVKKKRRAVFSFSMYWMVLTLGPILVGASIAATSYITSLRLLDSEAIST VYDQLLRWLPFILSSSAFVGLYLLVPNKKVQFSHAVVGAMIAAVLFELSKKGFAAYITQF PSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAALGEREHWRPAEDVIQSLPNNDTEL EKDTQRDRFDSES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-100 1x 100 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF488A conjugate, 0.1mg/mL
BNC881571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF647 conjugate, 0.1mg/mL
BNC472552-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (111-1C5), CF640R conjugate, 0.1mg/mL
BNC401038-500 1x 500 µL

CD45RA (111-1C5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details