Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Protein translocase subunit SecF (secF)

This Recombinant Synechocystis sp. Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q55611

Expression Region

1-315

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLDLFKWEKPAWIVSSLLVLISIFAMAISWAQFQAPFRPGLDFVGGTRLQLQLECASSN NCPAAIDVAEVQDILGGVGLGNSSVQVIEDYTLSIRQQTLDVEQREAVQKALNEGIGKFD PETIQIDTVGPTVGKALFRSGVLALVISLLGIIIYLTIRFQLDYAVFAIIALLYDALITM GAFAIFGLVGGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRETLERHSDWDINHVVDDAV NQTLTRSINTSLTTSLPLVAIFLFGGDSLKFFALALIIGFASGVYSSIFMATTLWAWWRK WRSPKNPPREMVAEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Skin
CP565581 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
Recombinant Human G-CSF protein (His Tag)
PKSH034164-01 20 µg

Recombinant Human G-CSF protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human G-CSF protein (His Tag)
PKSH034164-02 100 µg

Recombinant Human G-CSF protein (His Tag)

Sign In for Pricing
View Details
NAT10 Polyclonal Antibody
E-AB-11420-01 20 µL

NAT10 Polyclonal Antibody

Sign In for Pricing
View Details
NAT10 Polyclonal Antibody
E-AB-11420-02 60 µL

NAT10 Polyclonal Antibody

Sign In for Pricing
View Details
NAT10 Polyclonal Antibody
E-AB-11420-03 120 µL

NAT10 Polyclonal Antibody

Sign In for Pricing
View Details