Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Protein translocase subunit SecF (secF)

This Recombinant Synechocystis sp. Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q55611

Expression Region

1-315

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLDLFKWEKPAWIVSSLLVLISIFAMAISWAQFQAPFRPGLDFVGGTRLQLQLECASSN NCPAAIDVAEVQDILGGVGLGNSSVQVIEDYTLSIRQQTLDVEQREAVQKALNEGIGKFD PETIQIDTVGPTVGKALFRSGVLALVISLLGIIIYLTIRFQLDYAVFAIIALLYDALITM GAFAIFGLVGGVEVDSLFLVALLTIIGFSVNDTVVIYDRVRETLERHSDWDINHVVDDAV NQTLTRSINTSLTTSLPLVAIFLFGGDSLKFFALALIIGFASGVYSSIFMATTLWAWWRK WRSPKNPPREMVAEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NSE(Neuron Specific Enolase) ELISA Kit
SYP-M0049-01 48 Well

Mouse NSE(Neuron Specific Enolase) ELISA Kit

Sign In for Pricing
View Details
Mouse NSE(Neuron Specific Enolase) ELISA Kit
SYP-M0049-02 96 Well

Mouse NSE(Neuron Specific Enolase) ELISA Kit

Sign In for Pricing
View Details
CR1L Lentiviral Activation Particles (h)
sc-405453-LAC 200 µL

CR1L Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
CKMT2 Rabbit pAb, PE-Cy7 conjugated
orb2890754 100 µL

CKMT2 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody [Clone ID: OTI6C6]
TA505644S 30 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody [Clone ID: OTI6C6]

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)
MBS2056138-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)

Sign In for Pricing
View Details