Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

This Recombinant Ashbya gossypii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Mitochondrial thiamine pyrophosphate carrier 1

UniProt

Q75EP3

Expression Region

1-317

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEH KYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAH SLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWA IAATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVD AKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVY QRCLRLLEPTRAPQLPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-100 1x 100 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details