Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstC (pstC)

This Recombinant Phosphate transport system permease protein pstC (pstC) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC

UniProt

P0AGH9

Expression Region

1-319

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATKPAFNPPGKKGDIIFSVLVKLAALIVLLMLGGIIVSLIISSWPSIQKFGLAFLWTK EWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLA AIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIM IIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALG ETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFI VLAASKFMIMRLAKNEGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drying Oven BODR-7102
BODR-7102 1 Unit

Drying Oven BODR-7102

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), Biotin conjugate, 0.1mg/mL
BNCB0668-100 1x 100 µL

MART-1 / Melan-A (A103), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843R-01 25 µg

Elab Fluor® Violet 500 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843R-02 100 µg

Elab Fluor® Violet 500 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Noelin (OLFM1) Human Gene Knockout Kit (CRISPR)
KN400283 1 Kit

Noelin (OLFM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details