Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstC (pstC)

This Recombinant Phosphate transport system permease protein pstC (pstC) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstC

UniProt

P0AGH9

Expression Region

1-319

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATKPAFNPPGKKGDIIFSVLVKLAALIVLLMLGGIIVSLIISSWPSIQKFGLAFLWTK EWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLA AIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIM IIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALG ETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFI VLAASKFMIMRLAKNEGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FA20A (FAM20A) Human Gene Knockout Kit (CRISPR)
KN215864RB 1 Kit

FA20A (FAM20A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOX2 (NM_001098796) Human Recombinant Protein
TP311560L 1 mg

TOX2 (NM_001098796) Human Recombinant Protein

Sign In for Pricing
View Details
CSF-1-R Recombinant Rabbit monoclonal Antibody
HA751319 100 µL

CSF-1-R Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Wnt Inhibitory Factor 1/WIF1 Protein (His Tag)
PKSM040406 100 µg

Recombinant Mouse Wnt Inhibitory Factor 1/WIF1 Protein (His Tag)

Sign In for Pricing
View Details
HNRNPCL3 Human Gene Knockout Kit (CRISPR)
KN428813 1 Kit

HNRNPCL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HBS1L Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A7]
TA800552AM 100 µL

HBS1L Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A7]

Sign In for Pricing
View Details