Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27)

This Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 4, UCP 4, Solute carrier family 25 member 27

UniProt

O95847

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM TPWSMVFWLTYEKIREMSGVSPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RETNLB Polyclonal Antibody
E-AB-10579-01 20 µL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
RETNLB Polyclonal Antibody
E-AB-10579-02 60 µL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
RETNLB Polyclonal Antibody
E-AB-10579-03 120 µL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
RETNLB Polyclonal Antibody
E-AB-10579-04 200 µL

RETNLB Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene AM CHO
H10006.25G 25 g

Polystyrene AM CHO

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS708885 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details