Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27)

This Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 4, UCP 4, Solute carrier family 25 member 27

UniProt

O95847

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM TPWSMVFWLTYEKIREMSGVSPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbonic Anhydrase III, Muscle Specific (CA3) ELISA Kit
RDR-CA3-Hu-01 96 Tests

Human Carbonic Anhydrase III, Muscle Specific (CA3) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase III, Muscle Specific (CA3) ELISA Kit
RDR-CA3-Hu-02 48 Tests

Human Carbonic Anhydrase III, Muscle Specific (CA3) ELISA Kit

Sign In for Pricing
View Details
SCEL (Center) Rabbit Polyclonal Antibody
AP53810PU-N 400 µL

SCEL (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human HPGDS activation kit by CRISPRa
GA109114 1 Kit

Human HPGDS activation kit by CRISPRa

Sign In for Pricing
View Details
GAD65 (GAD2) Human Gene Knockout Kit (CRISPR)
KN423464 1 Kit

GAD65 (GAD2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NFAT3 (Ab-168/170) Antibody
8B8385-AAT 50 µg

NFAT3 (Ab-168/170) Antibody

Sign In for Pricing
View Details