Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27)

This Recombinant Human Mitochondrial uncoupling protein 4 (SLC25A27) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 4, UCP 4, Solute carrier family 25 member 27

UniProt

O95847

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM TPWSMVFWLTYEKIREMSGVSPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CFD Antibody
RC-5354-01 50 μL

Recombinant CFD Antibody

Sign In for Pricing
View Details
Recombinant CFD Antibody
RC-5354-02 100 µL

Recombinant CFD Antibody

Sign In for Pricing
View Details
Recombinant CFD Antibody
RC-5354-03 1 mL

Recombinant CFD Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA396890 100 µg

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APE1 Recombinant Mouse Monoclonal Antibody [12H2-R]
HA601212 100 µL

APE1 Recombinant Mouse Monoclonal Antibody [12H2-R]

Sign In for Pricing
View Details
Human OR11H7 activation kit by CRISPRa
GA118159 1 Kit

Human OR11H7 activation kit by CRISPRa

Sign In for Pricing
View Details