Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphatase-related protein type 1 (LPPR1)

This Recombinant Human Lipid phosphate phosphatase-related protein type 1 (LPPR1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 1, Plasticity-related gene 3 protein, PRG-3

UniProt

Q8TBJ4

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP GTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPL LRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGN ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLM AFPRIESPLETLSAQNHSASMTEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il22 (NM_016971) Mouse Recombinant Protein
TP720038L 500 µg

Il22 (NM_016971) Mouse Recombinant Protein

Sign In for Pricing
View Details
IRAKM (IRAK3) (NM_001142523) Human Over-expression Lysate
LC428144 20 µg

IRAKM (IRAK3) (NM_001142523) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS642335 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
RYK (C-term) Rabbit Polyclonal Antibody
AP14422PU-N 400 µL

RYK (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c-Jun (JUN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C1]
TA800571AM 100 µL

c-Jun (JUN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C1]

Sign In for Pricing
View Details
HDAC7A (NM_016596) Human Recombinant Protein
TP313214 20 µg

HDAC7A (NM_016596) Human Recombinant Protein

Sign In for Pricing
View Details