Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphatase-related protein type 1 (LPPR1)

This Recombinant Human Lipid phosphate phosphatase-related protein type 1 (LPPR1) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 1, Plasticity-related gene 3 protein, PRG-3

UniProt

Q8TBJ4

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP GTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPL LRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGN ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAF LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLM AFPRIESPLETLSAQNHSASMTEVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfesd Mouse Gene Knockout Kit (CRISPR)
KN514693 1 Kit

Rfesd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAALADL2 Human Gene Knockout Kit (CRISPR)
KN422328 1 Kit

NAALADL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTEN Polyclonal Antibody
E-AB-70070-01 60 µL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details
PTEN Polyclonal Antibody
E-AB-70070-02 120 µL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details
PTEN Polyclonal Antibody
E-AB-70070-03 200 µL

PTEN Polyclonal Antibody

Sign In for Pricing
View Details
URB1 Human Gene Knockout Kit (CRISPR)
KN426482 1 Kit

URB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details