Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Dipeptide transport system permease protein dppB (dppB)

This Recombinant Haemophilus influenzae Dipeptide transport system permease protein dppB (dppB) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppB

UniProt

P45096

Expression Region

1-333

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKFVFKRILMVIPTFIAITLITFALVHFIPGDPVEIMMGERGLTAEVHQQMMHQLGLDL PLYQQYFHYIGNVIQGDFGASFRTQQPVLTEFFTLFPATAELAFFALFWSLLGGIILGTI AAVKKDSWISHTVTAASLTGYSMPIFWWGLILILYVSPQLGLPQGGRLDNEFWIDTPTGF MLIDSWLSGVSGAFENAVKSLILPAIVLGTVPLAIITRMTRSAMLEVLGEDYIRTAKAKG LSYTRIVIVHALRNALIPVVTVVGLIVAQLLSGAVLTETIFSWPGIGKWIIDAIQARDYP VLQGSVLIIATIIIVVNLTVDLLYGVVNPRIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details