Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative phosphatidylcholine:ceramide cholinephosphotransferase 2 (sms-2)

This Recombinant Putative phosphatidylcholine:ceramide cholinephosphotransferase 2 (sms-2) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Putative phosphatidylcholine:ceramide cholinephosphotransferase 2, EC= 2.7.8.27, Sphingomyelin synthase 2

UniProt

Q20735

Expression Region

1-335

Origin

Caenorhabditis elegans

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNSSEFTDVLQSRDPCVSNGIVINIDPIDPEPTPIRKEFTCEDTFHHEHHGNSEGFKTL TAFLCLMLSAFLNFFLLTVIHDVVPRQPLPDLTFMIIPQQRWAWSVGDVLSTVSSVVAFT IIFLHHQRWIVLRRTFLLGAIMYGLRAVILGVTFLPPSFHNRDEICQPQVNRTAMYGMEI ATRFLTYVITLGLTSGQDKILCGDLMFSGHTVVLTIMYFVQLQYTPRGLVILRYIAAPIT FLGIAALVVSGGHYTMDVLIAYWLTSHVFWSYHQIFEMRKDDRPQAPLSRLWWFWLCYWF ESDVADGKLVNKWNWPLEGPQRMHTIMNRINYKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (HMB45 + A103 + T311), Biotin conjugate, 0.1mg/mL
BNCB0702-500 1x 500 µL

Melanoma Marker (HMB45 + A103 + T311), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tau (S262) Antibody
KC-43847-01 50 μL

Tau (S262) Antibody

Sign In for Pricing
View Details
Tau (S262) Antibody
KC-43847-02 100 µL

Tau (S262) Antibody

Sign In for Pricing
View Details
Tau (S262) Antibody
KC-43847-03 1 mL

Tau (S262) Antibody

Sign In for Pricing
View Details
Vgf Mouse Gene Knockout Kit (CRISPR)
KN518883 1 Kit

Vgf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Cyclin-D3 Antibody
RC-15261-01 50 μL

Recombinant Cyclin-D3 Antibody

Sign In for Pricing
View Details