Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 19 (TMEM19)

This Recombinant Human Transmembrane protein 19 (TMEM19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q96HH6

Expression Region

1-336

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLNDNICKRYIKMITNIVILSLIICISLAFWIISMTASTYYGNLRPISPWRWLFSVVV PVLIVSNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEVKKR LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL ACSAGDTWASEVGPVLSKSSPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGLDESTGMVVNSPTNKAR HIAGKPILDNNAVNLFSSVLIALLLPTAAWGFWPRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSMase2 (SMPD3) Rabbit Polyclonal Antibody
AP05301SU-N 100 µg

NSMase2 (SMPD3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Bright™ Violet 510 Rat IgG2a, κ Isotype Control[R35-95]
AN00822R1 20 Tests

Elab Bright™ Violet 510 Rat IgG2a, κ Isotype Control[R35-95]

Sign In for Pricing
View Details
ZNF789 (NM_213603) Human Over-expression Lysate
LC403881 20 µg

ZNF789 (NM_213603) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS708710 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
GFER Polyclonal Antibody
E-AB-10126-01 20 µL

GFER Polyclonal Antibody

Sign In for Pricing
View Details
GFER Polyclonal Antibody
E-AB-10126-02 60 µL

GFER Polyclonal Antibody

Sign In for Pricing
View Details