Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 19 (TMEM19)

This Recombinant Human Transmembrane protein 19 (TMEM19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q96HH6

Expression Region

1-336

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLNDNICKRYIKMITNIVILSLIICISLAFWIISMTASTYYGNLRPISPWRWLFSVVV PVLIVSNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEVKKR LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL ACSAGDTWASEVGPVLSKSSPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGLDESTGMVVNSPTNKAR HIAGKPILDNNAVNLFSSVLIALLLPTAAWGFWPRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant p95 Antibody
RC-4878-01 50 μL

Recombinant p95 Antibody

Sign In for Pricing
View Details
Recombinant p95 Antibody
RC-4878-02 100 µL

Recombinant p95 Antibody

Sign In for Pricing
View Details
Recombinant p95 Antibody
RC-4878-03 1 mL

Recombinant p95 Antibody

Sign In for Pricing
View Details
Gng12 (NM_025278) Mouse Tagged ORF Clone
MG200083 10 µg

Gng12 (NM_025278) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Integrin beta 1 (ITGB1) Mouse Monoclonal Antibody [Clone ID: B-D15]
AM31183PU-N 2 mL (200 Tests)

Integrin beta 1 (ITGB1) Mouse Monoclonal Antibody [Clone ID: B-D15]

Sign In for Pricing
View Details
Human C15orf15 (RSL24D1) activation kit by CRISPRa
GA109635 1 Kit

Human C15orf15 (RSL24D1) activation kit by CRISPRa

Sign In for Pricing
View Details