Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-20 (sra-20)

This Recombinant Serpentine receptor class alpha-20 (sra-20) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-20, Protein sra-20

UniProt

O17844

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELVESLRCASEGLTNALTSITVKVSFVFLATVILLSYYFAVLAIRALWNNNIFS NSTRLILIVCLLNSVVHQSTMMEIRIRQVYRSFVYSSEPCRLPFHFTDCEVELYFYYLTN YFSTYSVFSLTFDRLISYFFPKCYISYPYQVSISLLIIQLVFTLGTYYFGLYGVPKLGYV PICNYAPRLATNFVKINDFRTTIMVFCIIVTIFIYYLNVKSEKQIKRTSYSLGEQYLARE NVATSQSVCILIVLQFVCISVSSFGVNYIKSIKSTLSDEEYNKIAPFVVGVTYANLCLPL VIYFKTKLTIRKRRIRIGVMTSVYGDVGEHINRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor D Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-13130R-BF680-01 20 µL

Factor D Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Factor D Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-13130R-BF680-02 100 µL

Factor D Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)
MBS1200359-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)
MBS1200359-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)
MBS1200359-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)
MBS1200359-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Bifunctional protein pyrR (pyrR)

Sign In for Pricing
View Details