Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-20 (sra-20)

This Recombinant Serpentine receptor class alpha-20 (sra-20) spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-20, Protein sra-20

UniProt

O17844

Expression Region

1-339

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELVESLRCASEGLTNALTSITVKVSFVFLATVILLSYYFAVLAIRALWNNNIFS NSTRLILIVCLLNSVVHQSTMMEIRIRQVYRSFVYSSEPCRLPFHFTDCEVELYFYYLTN YFSTYSVFSLTFDRLISYFFPKCYISYPYQVSISLLIIQLVFTLGTYYFGLYGVPKLGYV PICNYAPRLATNFVKINDFRTTIMVFCIIVTIFIYYLNVKSEKQIKRTSYSLGEQYLARE NVATSQSVCILIVLQFVCISVSSFGVNYIKSIKSTLSDEEYNKIAPFVVGVTYANLCLPL VIYFKTKLTIRKRRIRIGVMTSVYGDVGEHINRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBED5 Rabbit pAb, BF700 conjugated
orb2840555 100 µL

ZBED5 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
ZNF157 Rabbit Polyclonal Antibody (Biotin)
orb452383 100 µL

ZNF157 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus MAB_4007c Protein (aa 1-313)
VAng-Yyj5473-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Abscessus MAB_4007c Protein (aa 1-313)

Sign In for Pricing
View Details
SPE Cartridge, C18, 40-60μm, 120Å, 1g/6mL, 30pcs/pk
15011062 1 Each

SPE Cartridge, C18, 40-60μm, 120Å, 1g/6mL, 30pcs/pk

Sign In for Pricing
View Details
Human Cluster Of Differentiation 72 (CD72) ELISA Kit
RDR-CD72-Hu-01 96 Tests

Human Cluster Of Differentiation 72 (CD72) ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 72 (CD72) ELISA Kit
RDR-CD72-Hu-02 48 Tests

Human Cluster Of Differentiation 72 (CD72) ELISA Kit

Sign In for Pricing
View Details