Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SERP0413 (SERP0413)

This Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SERP0413 (SERP0413) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SERP0413

UniProt

Q5HQY3

Expression Region

1-356

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAIIYNISVMVAGIYLFHRLQYSENKRMIFSKEYVTVLMTFVSLLLAAYPIPFQNEYL VHLTFVPLLFLGRYTNMIYTLTAAFIVSLVDVFIFGNSIIYGITLIVIAGIVSAVGPFLK QNDIISLLILNLISIIILLFLALLSPIYELVEILVLIPISFIITIASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEVSSKAEEKKQSLALLLIDIDGFKDVNDHYSHQ SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIRDYTLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTQEDRKSQRKVFKDADDMVHVAKSEGRNKVMFNPIVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR152 activation kit by CRISPRa
GA118137 1 Kit

Human GPR152 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TMEM229B activation kit by CRISPRa
GA116016 1 Kit

Human TMEM229B activation kit by CRISPRa

Sign In for Pricing
View Details
Vortioxetine
TRC-V760100-5MG 5 mg

Vortioxetine

Sign In for Pricing
View Details
Zfp804b Mouse Gene Knockout Kit (CRISPR)
KN519990 1 Kit

Zfp804b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rassf10 Mouse Gene Knockout Kit (CRISPR)
KN514515 1 Kit

Rassf10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPG7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G4]
TA504415BM 100 µL

SPG7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G4]

Sign In for Pricing
View Details