Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken 3-hydroxyacyl-CoA dehydratase (PTPLAD1)

This Recombinant Chicken 3-hydroxyacyl-CoA dehydratase (PTPLAD1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase, HACD, EC= 4.2.1.-, Protein tyrosine phosphatase-like protein PTPLAD1, Protein-tyrosine phosphatase-like A domain-containing protein 1

UniProt

Q5ZM57

Expression Region

1-362

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADCSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIE FLEPVEPKPVCRVTQRQLNITVQKKESSWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL KEKEEEKINKMKIESRVPKDPFKHLKKGYLIMYNLVQFLGFSWIFVNMTVRLFILGKDSF YDTFHTIADMMYFCQTLALMEILNSLIGLVRSPLIPAVIQVFGRNFILFVVLGSLEEMQS KAVVFFLFYFWSIIELFRYPYYMLSCMGIEWKPLTWLRYTSWIPLYPLGGLAEAVCLIQS IPIFSETGKFSLGLPNPLNVTIQFSFLLQMYLIALFLGLFVNFRYLYKQRKQHLGPKKRK MK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAPAP1 Monoclonal Antibody
MBS9525087-01 0.05 mL

SAPAP1 Monoclonal Antibody

Sign In for Pricing
View Details
SAPAP1 Monoclonal Antibody
MBS9525087-02 0.1 mL

SAPAP1 Monoclonal Antibody

Sign In for Pricing
View Details
SAPAP1 Monoclonal Antibody
MBS9525087-03 0.2 mL

SAPAP1 Monoclonal Antibody

Sign In for Pricing
View Details
SAPAP1 Monoclonal Antibody
MBS9525087-04 5x 0.2 mL

SAPAP1 Monoclonal Antibody

Sign In for Pricing
View Details
Zinc 2,4-pentanedionate hydrate
IN12856-01 25 g

Zinc 2,4-pentanedionate hydrate

Sign In for Pricing
View Details
Zinc 2,4-pentanedionate hydrate
IN12856-02 100 g

Zinc 2,4-pentanedionate hydrate

Sign In for Pricing
View Details