Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitoferrin-2 (SLC25A28)

This Recombinant Human Mitoferrin-2 (SLC25A28) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Mitoferrin-2, Mitochondrial RNA-splicing protein 3/4 homolog, MRS3/4, hMRS3/4, Mitochondrial iron transporter 2, Solute carrier family 25 member 28

UniProt

Q96A46

Expression Region

1-364

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSG PDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR IIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA IHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSH ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW RAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ILT7/CD85g/LILRA4 Antibody
NBP2-15013 0.1 mL

Rabbit Polyclonal ILT7/CD85g/LILRA4 Antibody

Sign In for Pricing
View Details
RPL17P10 CRISPR All-in-one AAV vector set (with saCas9)(Human)
40872151 3x 1.0 µg DNA

RPL17P10 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Vmn1r143 Protein Vector (Mouse) (pPM-C-HA)
PV245292 500 ng

Vmn1r143 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H1]
TA501044AM 100 µL

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H1]

Sign In for Pricing
View Details
FAM20A Protein Vector (Human) (pPM-C-HA)
19940021 500 ng

FAM20A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Herpes Simplex Virus-1 gD (84-175 a.a.)
MBS147142-01 0.1 mg

Recombinant Herpes Simplex Virus-1 gD (84-175 a.a.)

Sign In for Pricing
View Details