Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitoferrin-2 (SLC25A28)

This Recombinant Human Mitoferrin-2 (SLC25A28) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Mitoferrin-2, Mitochondrial RNA-splicing protein 3/4 homolog, MRS3/4, hMRS3/4, Mitochondrial iron transporter 2, Solute carrier family 25 member 28

UniProt

Q96A46

Expression Region

1-364

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSG PDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR IIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA IHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSH ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW RAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PP2C gamma/PPM1G Antibody (112) [FITC]
NBP2-89858F 0.1 mL

Rabbit Monoclonal PP2C gamma/PPM1G Antibody (112) [FITC]

Sign In for Pricing
View Details
Human Insulin ELISA Kit (Ultrasensitive)
PI608 96 Tests

Human Insulin ELISA Kit (Ultrasensitive)

Sign In for Pricing
View Details
Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/8280R) [DyLight 550]
NBP3-23986R 0.1 mL

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/8280R) [DyLight 550]

Sign In for Pricing
View Details
Rat Anaphase promoting complex subunit 1 (ANAPC1) ELISA kit
GTR10455529 96 Well

Rat Anaphase promoting complex subunit 1 (ANAPC1) ELISA kit

Sign In for Pricing
View Details
HRG Recombinant Protein
OPCD03981-50UG 50 µg

HRG Recombinant Protein

Sign In for Pricing
View Details
TRIM13 Antibody
MBS7045610-01 0.05 mL

TRIM13 Antibody

Sign In for Pricing
View Details